DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and AT5G08390

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_568194.2 Gene:AT5G08390 / 830737 AraportID:AT5G08390 Length:839 Species:Arabidopsis thaliana


Alignment Length:432 Identity:90/432 - (20%)
Similarity:149/432 - (34%) Gaps:158/432 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 GHVAQLTSGCWHPFNREQFLTA--ALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRD 343
            ||.:.:.|   ..|:..:.|.|  |..||:::|    ..|:.:|::|..  |.|:|..|.||:..
plant    57 GHSSGIDS---VTFDASEGLVAAGAASGTIKLW----DLEEAKVVRTLT--GHRSNCVSVNFHPF 112

  Fly   344 ATLIAAGCVDGSIQTWDTRKMFVNTTHCVR--DAHQKGSEITSIVFSYMGQQLATRSNDETMKLW 406
            ....|:|.:|.:::.||.||     ..|:.  ..|.:|  :..:.|:..|:.:.:...|..:|:|
plant   113 GEFFASGSLDTNLKIWDIRK-----KGCIHTYKGHTRG--VNVLRFTPDGRWIVSGGEDNVVKVW 170

  Fly   407 DLRQFKQPLHTWTNLFSRYDTTDCCFSPDDRLLVTGESLPKGQAEANLYFYSTKSYEEV------ 465
            ||...|. ||.:.:...:..:.|  |.|.:.||.|      |.|:..:.|:..:::|.:      
plant   171 DLTAGKL-LHEFKSHEGKIQSLD--FHPHEFLLAT------GSADKTVKFWDLETFELIGSGGTE 226

  Fly   466 ---QRIPVSNAHVVKTL-----------WHPKLNQLFVSCGNGT-----------------IKCY 499
               .|....|......|           |.|      :.|.:|.                 :.|.
plant   227 TTGVRCLTFNPDGKSVLCGLQESLKIFSWEP------IRCHDGVDVGWSNLSDMNVHEGKLLGCS 285

  Fly   500 YDEHRSIRGAKLCV---VKTHRKRQPMEMVGVSQIITPHALPLFRQEKSRTSRKRMEKARMDPVK 561
            |:::        ||   |....:.:||. .|.:|                 |....||       
plant   286 YNQN--------CVGVWVVDLSRTEPMS-GGATQ-----------------SNSHPEK------- 317

  Fly   562 SQRPDLPITSGQGGRVASSGGTLSSYVIRNLGLSKRVDDDQDPREAILKYAK-----DAAENPYW 621
                    |||.|...|......|..::..|..|::||       .:||..|     ..::|   
plant   318 --------TSGSGRDQAGLNDNSSKVILGKLPGSQKVD-------PLLKETKSLGKLSVSQN--- 364

  Fly   622 IAPAYKQTQPKAIFSEKLPAD-------------EPATKKPK 650
                          |:.||.|             :|..|:||
plant   365 --------------SDPLPKDTKSTGRSSVSQSSDPLVKEPK 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 61/281 (22%)
WD40 180..497 CDD:295369 56/256 (22%)
WD40 repeat 185..227 CDD:293791
WD40 repeat 233..268 CDD:293791
WD40 repeat 273..329 CDD:293791 13/49 (27%)
WD40 repeat 337..374 CDD:293791 11/38 (29%)
WD40 repeat 382..419 CDD:293791 10/36 (28%)
WD40 repeat 427..469 CDD:293791 11/50 (22%)
WD40 repeat 475..497 CDD:293791 5/49 (10%)
AT5G08390NP_568194.2 WD40 9..261 CDD:238121 54/234 (23%)
WD40 repeat 63..99 CDD:293791 11/44 (25%)
WD40 repeat 104..140 CDD:293791 11/40 (28%)
WD40 repeat 147..182 CDD:293791 10/35 (29%)
WD40 repeat 188..222 CDD:293791 10/41 (24%)
Katanin_con80 680..831 CDD:404758
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.