DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and AT2G43770

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_181905.1 Gene:AT2G43770 / 818980 AraportID:AT2G43770 Length:343 Species:Arabidopsis thaliana


Alignment Length:323 Identity:74/323 - (22%)
Similarity:131/323 - (40%) Gaps:56/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 AVLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENHPIRSLQYSVTGDMILVIS 248
            ||..:..:|:|..:.|||.|.::..|...|   ..::|..|:..:| .|..|.::..|..|:..|
plant    55 AVYTMKFNPAGTLIASGSHDREIFLWRVHG---DCKNFMVLKGHKN-AILDLHWTSDGSQIVSAS 115

  Fly   249 GNAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNR--EQFLTAALDGTLRIW 311
            .:...:..|.:        .|.| |..|:.   |.:.:.|.|  |..|  ...::.:.|||.::|
plant   116 PDKTVRAWDVE--------TGKQ-IKKMAE---HSSFVNSCC--PTRRGPPLIISGSDDGTAKLW 166

  Fly   312 QGLKSKEQLQVIKTRAQGGLRT-----NAASCNFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHC 371
            .            .|.:|.::|     ...:.:|:..|..|..|.||..::.||.||.....|  
plant   167 D------------MRQRGAIQTFPDKYQITAVSFSDAADKIFTGGVDNDVKVWDLRKGEATMT-- 217

  Fly   372 VRDAHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHTWTNLFSRY------DTTDC 430
             .:.||  ..||.:..|..|..|.|...|..:.:||:|.: .|.:....:|..:      :...|
plant   218 -LEGHQ--DTITGMSLSPDGSYLLTNGMDNKLCVWDMRPY-APQNRCVKIFEGHQHNFEKNLLKC 278

  Fly   431 CFSPDDRLLVTGESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHPKLNQLFVSCGN 493
            .:|||      |..:..|.::..::.:.|.|...:.::|.....|.:.::|| ...:..||.:
plant   279 SWSPD------GTKVTAGSSDRMVHIWDTTSRRTIYKLPGHTGSVNECVFHP-TEPIIGSCSS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 74/323 (23%)
WD40 180..497 CDD:295369 74/323 (23%)
WD40 repeat 185..227 CDD:293791 11/41 (27%)
WD40 repeat 233..268 CDD:293791 5/34 (15%)
WD40 repeat 273..329 CDD:293791 12/57 (21%)
WD40 repeat 337..374 CDD:293791 11/36 (31%)
WD40 repeat 382..419 CDD:293791 11/36 (31%)
WD40 repeat 427..469 CDD:293791 8/41 (20%)
WD40 repeat 475..497 CDD:293791 5/19 (26%)
AT2G43770NP_181905.1 WD40 49..340 CDD:238121 74/323 (23%)
WD40 repeat 57..94 CDD:293791 10/39 (26%)
WD40 repeat 99..135 CDD:293791 9/44 (20%)
WD40 repeat 142..177 CDD:293791 10/48 (21%)
WD40 repeat 183..219 CDD:293791 11/38 (29%)
WD40 repeat 227..265 CDD:293791 9/38 (24%)
WD40 repeat 275..299 CDD:293791 6/29 (21%)
WD40 repeat 317..340 CDD:293791 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.