DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and WDR61

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001290176.1 Gene:WDR61 / 80349 HGNCID:30300 Length:305 Species:Homo sapiens


Alignment Length:264 Identity:51/264 - (19%)
Similarity:86/264 - (32%) Gaps:92/264 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SDDEQSLAKRIPYTH--------------EVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWD 210
            |.|.|.||..   ||              |..:....:.:|::|..|.|..|.||:||..:..:|
Human   115 SPDSQYLATG---THVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFD 176

  Fly   211 FAGMDSSMRSFRQLQPCENH--PIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYI 273
            .|       :.:.|...|.|  |||||.:|....:::..|.:...|:.|            .|:.
Human   177 IA-------TGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYD------------VQHA 222

  Fly   274 SDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASC 338
            :......||.:                          |.                    .|.|.|
Human   223 NLAGTLSGHAS--------------------------WV--------------------LNVAFC 241

  Fly   339 NFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDETM 403
               .|.|...:...|.|::.||     |.|..||........::..:.::..|.::.:..:|:.:
Human   242 ---PDDTHFVSSSSDKSVKVWD-----VGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 298

  Fly   404 KLWD 407
            .::|
Human   299 HIYD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 46/252 (18%)
WD40 180..497 CDD:295369 43/230 (19%)
WD40 repeat 185..227 CDD:293791 12/41 (29%)
WD40 repeat 233..268 CDD:293791 7/34 (21%)
WD40 repeat 273..329 CDD:293791 3/55 (5%)
WD40 repeat 337..374 CDD:293791 11/36 (31%)
WD40 repeat 382..419 CDD:293791 3/26 (12%)
WD40 repeat 427..469 CDD:293791
WD40 repeat 475..497 CDD:293791
WDR61NP_001290176.1 WD40 13..302 CDD:238121 50/262 (19%)
WD 1 14..57
WD40 repeat 19..62 CDD:293791
WD 2 62..101
WD40 repeat 68..105 CDD:293791
WD 3 104..143 8/30 (27%)
WD40 repeat 110..146 CDD:293791 8/33 (24%)
WD 4 146..187 12/47 (26%)
WD40 repeat 152..188 CDD:293791 12/42 (29%)
WD 5 188..227 11/50 (22%)
WD40 repeat 193..229 CDD:293791 9/47 (19%)
WD 6 230..269 16/92 (17%)
WD40 repeat 236..271 CDD:293791 13/42 (31%)
WD 7 272..305 3/31 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.