Sequence 1: | NP_611832.1 | Gene: | CG5543 / 37768 | FlyBaseID: | FBgn0034908 | Length: | 655 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001290176.1 | Gene: | WDR61 / 80349 | HGNCID: | 30300 | Length: | 305 | Species: | Homo sapiens |
Alignment Length: | 264 | Identity: | 51/264 - (19%) |
---|---|---|---|
Similarity: | 86/264 - (32%) | Gaps: | 92/264 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 160 SDDEQSLAKRIPYTH--------------EVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWD 210
Fly 211 FAGMDSSMRSFRQLQPCENH--PIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYI 273
Fly 274 SDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASC 338
Fly 339 NFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDETM 403
Fly 404 KLWD 407 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5543 | NP_611832.1 | WD40 | <172..519 | CDD:225201 | 46/252 (18%) |
WD40 | 180..497 | CDD:295369 | 43/230 (19%) | ||
WD40 repeat | 185..227 | CDD:293791 | 12/41 (29%) | ||
WD40 repeat | 233..268 | CDD:293791 | 7/34 (21%) | ||
WD40 repeat | 273..329 | CDD:293791 | 3/55 (5%) | ||
WD40 repeat | 337..374 | CDD:293791 | 11/36 (31%) | ||
WD40 repeat | 382..419 | CDD:293791 | 3/26 (12%) | ||
WD40 repeat | 427..469 | CDD:293791 | |||
WD40 repeat | 475..497 | CDD:293791 | |||
WDR61 | NP_001290176.1 | WD40 | 13..302 | CDD:238121 | 50/262 (19%) |
WD 1 | 14..57 | ||||
WD40 repeat | 19..62 | CDD:293791 | |||
WD 2 | 62..101 | ||||
WD40 repeat | 68..105 | CDD:293791 | |||
WD 3 | 104..143 | 8/30 (27%) | |||
WD40 repeat | 110..146 | CDD:293791 | 8/33 (24%) | ||
WD 4 | 146..187 | 12/47 (26%) | |||
WD40 repeat | 152..188 | CDD:293791 | 12/42 (29%) | ||
WD 5 | 188..227 | 11/50 (22%) | |||
WD40 repeat | 193..229 | CDD:293791 | 9/47 (19%) | ||
WD 6 | 230..269 | 16/92 (17%) | |||
WD40 repeat | 236..271 | CDD:293791 | 13/42 (31%) | ||
WD 7 | 272..305 | 3/31 (10%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |