DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and taf5

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001032508.1 Gene:taf5 / 641491 ZFINID:ZDB-GENE-051120-180 Length:743 Species:Danio rerio


Alignment Length:491 Identity:108/491 - (21%)
Similarity:179/491 - (36%) Gaps:149/491 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 QIEDVAEDLESQHLKEVMGISGFGRKAAKVF-----------DINEQIEKARVTRPGMDKKREE- 108
            ||:.::..|..:..:||        ...|||           .::::.|:|. ...|..||::. 
Zfish   294 QIDSMSGSLAGEARREV--------NKVKVFYGLLKEPEIEVPLDDEDEEAE-NEEGKPKKKKTK 349

  Fly   109 -----SKPKEDDQKDEEEEDVIGPLPPAVTTDK-EKA--TKESSKD------------------- 146
                 ||.|:.|....::..:  |||....:|| :|.  .|||:|.                   
Zfish   350 KDSMGSKSKKQDPNAPQQNRI--PLPELKDSDKLDKIMYMKESTKRIRLGPETLPSICFYTFLNA 412

  Fly   147 -------EDSDDDDYSS------------------------------DEDSDDEQSLAKRI---P 171
                   :.:||....:                              |::|||   :.:||   .
Zfish   413 YQGLTAVDFTDDSSLIAGGFADSTVRVWSVTPKKLRKVKSAADLNLIDKESDD---VLERIMDEK 474

  Fly   172 YTHEVQMQHG-SRAVLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQL--QPCENHPIR 233
            .:.|.::.|| |..|..::..|....|:|.|.|..:..|       |:::|..|  ....|:|:.
Zfish   475 TSSESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLW-------SLQTFTCLVGYKGHNYPVW 532

  Fly   234 SLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNREQ 298
            ..|:|..|...:....:..|::...|.::.|..            ..||:|.:|...:|| |...
Zfish   533 DTQFSPFGYYFVSGGHDRVARLWATDHYQPLRI------------FAGHLADVTCTRFHP-NSNY 584

  Fly   299 FLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRK 363
            ..|.:.|.|:|:|..|..  ....|.|..:|.:.:.|    |:.:...:|:|..||.:..||   
Zfish   585 VATGSSDRTVRLWDVLNG--NCVRIFTGHKGPIHSLA----FSPNGKFLASGSTDGRVLLWD--- 640

  Fly   364 MFVNTTHCVRDAHQKG--SEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHTWTNLFSRYD 426
                ..|.:..|..||  ..|.::.||..|:.:|:.|.|.|::|||:.:....:.|         
Zfish   641 ----IGHGLMIAELKGHTGTIYALKFSRDGEIIASGSIDNTVRLWDVMRAIDDVET--------- 692

  Fly   427 TTDCCFSPDDRLLVTGE-SLPKGQAEANLYFYSTKS 461
                    ||....||. .||....|..|..|.:||
Zfish   693 --------DDFTAATGHIHLPDNSQELLLGTYHSKS 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 73/296 (25%)
WD40 180..497 CDD:295369 72/288 (25%)
WD40 repeat 185..227 CDD:293791 10/43 (23%)
WD40 repeat 233..268 CDD:293791 6/34 (18%)
WD40 repeat 273..329 CDD:293791 15/55 (27%)
WD40 repeat 337..374 CDD:293791 8/36 (22%)
WD40 repeat 382..419 CDD:293791 12/36 (33%)
WD40 repeat 427..469 CDD:293791 11/36 (31%)
WD40 repeat 475..497 CDD:293791
taf5NP_001032508.1 TAF5_NTD2 154..286 CDD:176269
WD40 <392..683 CDD:225201 69/326 (21%)
WD40 415..682 CDD:238121 67/302 (22%)
WD40 repeat 416..484 CDD:293791 9/70 (13%)
WD40 repeat 490..526 CDD:293791 9/42 (21%)
WD40 repeat 531..567 CDD:293791 6/47 (13%)
WD40 repeat 574..609 CDD:293791 11/37 (30%)
WD40 repeat 615..651 CDD:293791 10/46 (22%)
WD40 repeat 657..683 CDD:293791 10/25 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.