DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and WDR33

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_060853.3 Gene:WDR33 / 55339 HGNCID:25651 Length:1336 Species:Homo sapiens


Alignment Length:656 Identity:130/656 - (19%)
Similarity:244/656 - (37%) Gaps:178/656 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FKKMDKEQMIRQIEDVAEDLESQHLKEVMGISGFGRKAAKVFDINEQIEKARVTRPGMDKKREES 109
            |:.....|:..:..|.|:....|.|               .|| .:::.|| |.|..:|......
Human    17 FQHQAPRQLFYKRPDFAQQQAMQQL---------------TFD-GKRMRKA-VNRKTIDYNPSVI 64

  Fly   110 KPKEDD--QKDEEEEDVIGP--------LPP---------AVTTDKEKATKESSKDEDSDDDDYS 155
            |..|:.  |:|:.:...|.|        :||         ||||   |..:.|            
Human    65 KYLENRIWQRDQRDMRAIQPDAGYYNDLVPPIGMLNNPMNAVTT---KFVRTS------------ 114

  Fly   156 SDEDSDDEQSLAKRIPYTHEVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRS 220
                             |::|:.     .|..:...|.|.|||:|:...:...|:  |:..   :
Human   115 -----------------TNKVKC-----PVFVVRWTPEGRRLVTGASSGEFTLWN--GLTF---N 152

  Fly   221 FRQLQPCENHPIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTK---GH 282
            |..:....:.|:|::.:| ..||.::.:        |..|:.|       .:.|:|:..|   .|
Human   153 FETILQAHDSPVRAMTWS-HNDMWMLTA--------DHGGYVK-------YWQSNMNNVKMFQAH 201

  Fly   283 VAQLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDATLI 347
            ...:....:.|.: .:|.|.:.|||:|||..|:..|:      |...|...:....:::....|:
Human   202 KEAIREASFSPTD-NKFATCSDDGTVRIWDFLRCHEE------RILRGHGADVKCVDWHPTKGLV 259

  Fly   348 AAGCVDGS--IQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQ 410
            .:|..|..  |:.||.:     |...:...|...:.:..:..:..|..|.|.|.|...||:|:|.
Human   260 VSGSKDSQQPIKFWDPK-----TGQSLATLHAHKNTVMEVKLNLNGNWLLTASRDHLCKLFDIRN 319

  Fly   411 FKQPLHTWTNLFSRYDTTDCCFSP-DDRLLVTGESLPKGQAEANLYFYSTKSYEEVQRIPVSNAH 474
            .|:.|..:..  .:.:.|...:.| .:.|..:|.|      :.:|.|:.....:||..:.:::..
Human   320 LKEELQVFRG--HKKEATAVAWHPVHEGLFASGGS------DGSLLFWHVGVEKEVGGMEMAHEG 376

  Fly   475 VVKTL-WHPKLNQLFVSCGNGTIKCYYDEHRSIRGAKLCVVKTHRKRQPMEMV-GVSQ------I 531
            ::.:| ||| |..:..|..|.....::..:|.  |.|:      |.|..:.:: |:|:      .
Human   377 MIWSLAWHP-LGHILCSGSNDHTSKFWTRNRP--GDKM------RDRYNLNLLPGMSEDGVEYDD 432

  Fly   532 ITPHALPLF------RQEKSRTSRKRMEKARMDPVKSQRPDLPITSGQGGRVASSGGTLSSYVIR 590
            :.|::|.:.      .|.|....:::|.|...:.::...|.|                       
Human   433 LEPNSLAVIPGMGIPEQLKLAMEQEQMGKDESNEIEMTIPGL----------------------- 474

  Fly   591 NLGLSKRVDDDQD--PREAILKYAKDAAENPYWIAPAYKQTQ-----PKAIFSEKLPADEPATKK 648
            :.|:.:.:..||.  |::.: .|||..   |.....|:.|.:     |..:.::: ..|....:|
Human   475 DWGMEEVMQKDQKKVPQKKV-PYAKPI---PAQFQQAWMQNKVPIPAPNEVLNDR-KEDIKLEEK 534

  Fly   649 PKTEAD 654
            .||:|:
Human   535 KKTQAE 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 75/353 (21%)
WD40 180..497 CDD:295369 70/323 (22%)
WD40 repeat 185..227 CDD:293791 10/41 (24%)
WD40 repeat 233..268 CDD:293791 7/34 (21%)
WD40 repeat 273..329 CDD:293791 16/58 (28%)
WD40 repeat 337..374 CDD:293791 7/38 (18%)
WD40 repeat 382..419 CDD:293791 11/36 (31%)
WD40 repeat 427..469 CDD:293791 9/42 (21%)
WD40 repeat 475..497 CDD:293791 7/22 (32%)
WDR33NP_060853.3 WD 1 117..156 11/48 (23%)
WD40 121..>405 CDD:225201 70/325 (22%)
WD40 121..402 CDD:238121 70/322 (22%)
WD40 repeat 122..159 CDD:293791 10/41 (24%)
WD 2 159..198 11/54 (20%)
WD40 repeat 165..200 CDD:293791 10/50 (20%)
WD 3 200..239 12/45 (27%)
WD40 repeat 205..241 CDD:293791 12/42 (29%)
WD 4 242..283 8/45 (18%)
WD40 repeat 248..285 CDD:293791 7/41 (17%)
WD 5 286..325 10/38 (26%)
WD40 repeat 291..328 CDD:293791 11/36 (31%)
WD 6 329..369 9/47 (19%)
WD40 repeat 336..371 CDD:293791 8/40 (20%)
WD 7 373..412 10/47 (21%)
WD40 repeat 378..402 CDD:293791 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 568..1336
Med15 594..>989 CDD:255446
Collagen 730..791 CDD:189968
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.