DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and Poc1b

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_082016.1 Gene:Poc1b / 382406 MGIID:1918511 Length:476 Species:Mus musculus


Alignment Length:484 Identity:101/484 - (20%)
Similarity:164/484 - (33%) Gaps:163/484 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 KGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQG----GLRTNAASCNF 340
            |||.|.:||..:.| |.:|..||:.|..|.:|.          :|..|:.    |.:....|..|
Mouse    15 KGHKAAITSADFSP-NCKQIATASWDTFLMLWS----------LKPHARAYRYVGHKDVVTSLQF 68

  Fly   341 NRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSE-------ITSIVFSYMGQQLATRS 398
            :....|:|:...|.:::.|            |.|...|.||       :.|:.||..||.|.|.|
Mouse    69 SPQGNLLASASRDRTVRLW------------VLDRKGKSSEFKAHTAPVRSVDFSADGQLLVTAS 121

  Fly   399 NDETMKLWDLRQFKQPLHTWTNLFSRYDTTD---CC-FSPDDRLLVT------------------ 441
            .|:::|:|.:  |:|..     |:|.|..|.   |. ||||.||:|:                  
Mouse   122 EDKSIKVWSM--FRQRF-----LYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCV 179

  Fly   442 ------------------GESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHPKLNQLF 488
                              |..:....::..:..:..:..:.:|...|.:..|....:||..|.|.
Mouse   180 NNFSDSVGFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLGNSLV 244

  Fly   489 VSCGNGTIKCYYDEHRSIRGAKLCVVKTHRKRQPMEMVGVS-------------QII-------- 532
            .:..:||:|..    ..|.|..:..::.|  ..|:..|..|             |::        
Mouse   245 TASSDGTVKML----DLIEGRLIYTLQGH--TGPVFTVSFSKDGELLTSGGADAQVLIWRTNFIH 303

  Fly   533 -----------------TPHALPLF-RQEKSRTSRKRM-----EKARMDPVKSQRPDLPITSGQG 574
                             :||.|.:: |...|...||..     ::..||...|..|.:.:.|...
Mouse   304 LHCKDPKRNLKRLHFEASPHLLDIYPRSPHSHEDRKETIEINPKREVMDLQSSSPPVVDVLSFDS 368

  Fly   575 GRVASS--------GGTLSSYVIRNL--------GLSKRVDDDQD-PREAILKYAKDAAENPYWI 622
            ..:..|        |..:..|.:..|        .:.||.:|..| |.|::...       |..:
Mouse   369 TTMTDSTYRAVPGKGEDICRYFLNPLLMPECSSTTVKKRPEDVSDVPSESLRSV-------PLAV 426

  Fly   623 APAYKQ--------TQPKAIFSEKLPADE 643
            |.|.:.        ||..:|..::|...|
Mouse   427 ADALEHIMEQLNILTQTVSILEQRLSLTE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 67/289 (23%)
WD40 180..497 CDD:295369 63/267 (24%)
WD40 repeat 185..227 CDD:293791
WD40 repeat 233..268 CDD:293791
WD40 repeat 273..329 CDD:293791 16/48 (33%)
WD40 repeat 337..374 CDD:293791 7/36 (19%)
WD40 repeat 382..419 CDD:293791 13/36 (36%)
WD40 repeat 427..469 CDD:293791 11/81 (14%)
WD40 repeat 475..497 CDD:293791 7/21 (33%)
Poc1bNP_082016.1 WD40 10..298 CDD:238121 71/318 (22%)
WD40 14..>300 CDD:225201 71/320 (22%)
WD 1 16..55 15/49 (31%)
WD40 repeat 21..58 CDD:293791 12/47 (26%)
WD 2 58..97 10/50 (20%)
WD40 repeat 63..100 CDD:293791 11/48 (23%)
WD 3 100..139 14/45 (31%)
WD40 repeat 106..142 CDD:293791 15/42 (36%)
WD 4 142..181 9/38 (24%)
WD40 repeat 147..182 CDD:293791 8/34 (24%)
WD 5 183..223 1/39 (3%)
WD40 repeat 190..225 CDD:293791 2/34 (6%)
WD 6 226..265 11/42 (26%)
WD40 repeat 231..267 CDD:293791 10/39 (26%)
WD 7 268..307 5/40 (13%)
WD40 repeat 273..299 CDD:293791 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.