DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and CG10931

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:343 Identity:71/343 - (20%)
Similarity:141/343 - (41%) Gaps:51/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EQSLAKRIPYTHEVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPC 227
            |.|::......|.: :.| |..|..|....:|..|||.|.|..:..||       :.:.|.:|..
  Fly    39 ENSMSPGYAIKHSL-LGH-SGCVTGLKFSSNGENLVSSSGDRLLKLWD-------LSATRCIQSL 94

  Fly   228 ENH--PIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGC 290
            ..|  .:..:.:|..|   |:.|.:....|...|...|| |.|         ..:||.....|.|
  Fly    95 AGHGDGVNDVAWSAAG---LIASCSDDMTVRLWDARSKL-CVK---------VLEGHSRYSFSCC 146

  Fly   291 WHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGS 355
            ::| ......:.:.|.|:|:|. :::.:.|:::...     :....|.:|:||..:......||.
  Fly   147 FNP-QANLLASTSFDETVRLWD-VRTGKTLKIVHAH-----QDPITSVDFHRDGNIFVTSSYDGL 204

  Fly   356 IQTWDTRKMFVNTTHCVRD-AHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQP--LHT 417
            ::.||:     :|.|.::. .......:..:.||..|:.:.:.:.:.|::||:   :|:|  :.|
  Fly   205 VRLWDS-----STGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTLRLWN---YKKPKCMRT 261

  Fly   418 WTNLFSRYDTTDCCFSPDDRLLVTGESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHP 482
            :....:.:..::..||....:.:.     .|..:..|..::.::.|.||:|......::.|..||
  Fly   262 YRGHLNEFYCSNSNFSTTGGIWIV-----SGSEDNTLCIWNLQTRELVQKISTEGDQILSTHCHP 321

  Fly   483 KLNQLFVSCGNGTIKCYY 500
            ..|.:    .:|.::..|
  Fly   322 TANVI----ASGALQNSY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 69/334 (21%)
WD40 180..497 CDD:295369 67/321 (21%)
WD40 repeat 185..227 CDD:293791 12/41 (29%)
WD40 repeat 233..268 CDD:293791 9/34 (26%)
WD40 repeat 273..329 CDD:293791 10/55 (18%)
WD40 repeat 337..374 CDD:293791 10/36 (28%)
WD40 repeat 382..419 CDD:293791 9/38 (24%)
WD40 repeat 427..469 CDD:293791 7/41 (17%)
WD40 repeat 475..497 CDD:293791 5/21 (24%)
CG10931NP_611261.1 WD40 <48..341 CDD:225201 69/334 (21%)
WD40 49..341 CDD:238121 69/333 (21%)
WD40 repeat 59..96 CDD:293791 12/43 (28%)
WD40 repeat 102..137 CDD:293791 10/47 (21%)
WD40 repeat 142..178 CDD:293791 8/37 (22%)
WD40 repeat 185..220 CDD:293791 10/39 (26%)
WD40 repeat 227..263 CDD:293791 9/38 (24%)
WD40 repeat 271..309 CDD:293791 8/42 (19%)
WD40 repeat 314..340 CDD:293791 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.