DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and taf5l

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_956146.1 Gene:taf5l / 334055 ZFINID:ZDB-GENE-030131-5987 Length:601 Species:Danio rerio


Alignment Length:469 Identity:92/469 - (19%)
Similarity:161/469 - (34%) Gaps:144/469 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 AKESTEASGNGG-GFKKMDKEQMIRQIEDVAEDLES--------------------QHLKEVMG- 74
            :..||.||.:|. |.::::....:.|.|...|:|:.                    ||.::::. 
Zfish   221 SSSSTWASVDGSEGAERLEVPAGLPQNEAALENLQDCIKRVREGPPSLTTVCFYAFQHTEQLLNT 285

  Fly    75 ----------ISGFGRKAAKVFDINEQIEKARVTRPGMDKKREESKPKEDDQKDEEEEDVIGPLP 129
                      .:||...|.|::.:     :||..:.|        ..|.|..|.....||:    
Zfish   286 AEVSADSRLLAAGFDNSAVKLWSL-----RARKLKAG--------PHKADVSKIRLACDVL---- 333

  Fly   130 PAVTTDKEKATKESSKDEDSDDDDYSSDEDSDDEQSLAKRIPYTHEVQMQHGSRAVL---ALAGD 191
                            :|::||:|.|..                 |::...|....:   |...|
Zfish   334 ----------------EEEADDEDASGS-----------------EIKTLRGHSGPVYRTAFLTD 365

  Fly   192 PSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENH--PIRSLQYSVTGDMILVISGNAQAK 254
            .||  |:|.|.|..:.:||       ::||........|  |:..:..|.........|.:..|:
Zfish   366 ASG--LLSCSEDSTVRYWD-------LKSFTNTVLYRGHAYPVWDVDVSPCSLYFSTASHDRTAR 421

  Fly   255 VLDRDGFEKLECCKGDQYISDMSRT------KGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQG 313
                              :...:||      .||::.:....:|| |.....|.:.|.|:|:|  
Zfish   422 ------------------LWSFARTYPLRLYAGHLSDVDCVKFHP-NSNYIATGSTDKTVRLW-- 465

  Fly   314 LKSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRK--MFVNTTHCVRDAH 376
                ...|....|...|.|....:..|:.:...:|:...|..::.||...  :|       :|..
Zfish   466 ----STRQGASVRLFTGHRGPVLTLAFSPNGKYLASAGEDQRLKLWDLASGGLF-------KDLR 519

  Fly   377 QKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHT---WTNLFSRY-----DTTDCCFS 433
            .....|:|:.||.....:|:.|.|.|:::||:|.......|   .:.|..:|     :..:..|.
Zfish   520 GHTDTISSLSFSQDSSLVASASMDNTVRVWDIRNAHGSAPTDGCSSELIGQYTGSTSNILNVQFM 584

  Fly   434 PDDRLLVTGESLPK 447
            ..:.|||||.::.|
Zfish   585 ACNLLLVTGTAMEK 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 63/297 (21%)
WD40 180..497 CDD:295369 62/289 (21%)
WD40 repeat 185..227 CDD:293791 12/44 (27%)
WD40 repeat 233..268 CDD:293791 3/34 (9%)
WD40 repeat 273..329 CDD:293791 14/61 (23%)
WD40 repeat 337..374 CDD:293791 6/38 (16%)
WD40 repeat 382..419 CDD:293791 12/39 (31%)
WD40 repeat 427..469 CDD:293791 7/21 (33%)
WD40 repeat 475..497 CDD:293791
taf5lNP_956146.1 TAF5_NTD2 66..200 CDD:176269
WD40 <227..581 CDD:225201 83/444 (19%)
WD40 289..593 CDD:238121 77/394 (20%)
WD40 repeat 357..394 CDD:293791 12/45 (27%)
WD40 repeat 400..436 CDD:293791 5/53 (9%)
WD40 repeat 441..477 CDD:293791 10/42 (24%)
WD40 repeat 484..519 CDD:293791 7/41 (17%)
WD40 repeat 525..572 CDD:293791 13/46 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.