DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and Ercc8

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_017446310.1 Gene:Ercc8 / 310071 RGDID:1311570 Length:404 Species:Rattus norvegicus


Alignment Length:253 Identity:52/253 - (20%)
Similarity:92/253 - (36%) Gaps:76/253 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LQPCENHPIRSLQYSVTG--DMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTKG--HVA 284
            ::|.|.      :|.::|  |.::|:..      |:....:....||.   :..:.|:..  |..
  Rat    51 IEPVEG------RYMLSGGSDGVIVLYD------LENASRQPYYTCKA---VCSVGRSHPDVHKY 100

  Fly   285 QLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDAT---- 345
            .:.:..|:|.:...|.:::.|.||::|.                  ..|..|:..||.:.|    
  Rat   101 SVETVQWYPHDTGMFTSSSFDKTLKVWD------------------TNTLQAADVFNFEETVYSH 147

  Fly   346 ----------LIAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFS----YMGQQLAT 396
                      |:|.|.....:|..|.:.  .:.:|.::...|   ||.::.:|    |:   |||
  Rat   148 HMSPAATKHCLVAVGTRGPKVQLCDLKS--GSCSHILQGHRQ---EILAVSWSPRYDYI---LAT 204

  Fly   397 RSNDETMKLWDLRQFKQPLHTW-------------TNLFSRYDTTDCCFSPDDRLLVT 441
            .|.|..:||||:|:....|.|.             .|..........||:.|...|:|
  Rat   205 ASADSRVKLWDVRRASGCLLTLDQHNGKKSQAVESANTAHNGKVNGLCFTSDGLHLLT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 52/253 (21%)
WD40 180..497 CDD:295369 52/253 (21%)
WD40 repeat 185..227 CDD:293791 0/2 (0%)
WD40 repeat 233..268 CDD:293791 5/36 (14%)
WD40 repeat 273..329 CDD:293791 9/57 (16%)
WD40 repeat 337..374 CDD:293791 9/50 (18%)
WD40 repeat 382..419 CDD:293791 15/53 (28%)
WD40 repeat 427..469 CDD:293791 5/15 (33%)
WD40 repeat 475..497 CDD:293791
Ercc8XP_017446310.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.