DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and pfs-2

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001380152.1 Gene:pfs-2 / 175092 WormBaseID:WBGene00011051 Length:809 Species:Caenorhabditis elegans


Alignment Length:391 Identity:70/391 - (17%)
Similarity:147/391 - (37%) Gaps:71/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VLALAGDPSGARLVSGSIDYDMCFWDFAGMDSSMRSFRQLQPCENHPIRSLQYSVTGDMILVISG 249
            |.::...|.|.||::|....:...|     :.:..:|..:....:..||:|:::.....:|    
 Worm   136 VYSVCWSPEGKRLITGCQTGEFTLW-----NGTAFNFETILQAHDSAIRALKWASNEQWLL---- 191

  Fly   250 NAQAKVLDRDGFEKLECCKGDQYISDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRIWQGL 314
                 ..|:.|:.|.    ....:::......|..:...|........:|.||:.|||.|:|...
 Worm   192 -----SADQGGYVKY----WQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFA 247

  Fly   315 KSKEQLQVIKTRAQGGLRTNAASCNFNRDATLIAAGCVDGS--IQTWDTRKMFVNTTHCVRDAHQ 377
            :..|:      |...|........:::....|||.|..|..  ::.||.:     :..|:....:
 Worm   248 RYTEE------RVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPK-----SGSCLATLQE 301

  Fly   378 KGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHTWTNLFSRYDTTDCCFSP-DDRLLVT 441
            ..|.:.::.|:..|..|.|...|..:|::|:|..|: :.|:.  ..:.:.....:.| .:.|.|:
 Worm   302 HKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKE-MRTYR--AHKKEVISLAWHPIHEGLFVS 363

  Fly   442 GESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTL-WHPKLNQLFVSCGNGTIKCYYDEHRS 505
                  |..:.::.::.....:|:..:..::...:.:: ||| |..:..:..|.....::..:| 
 Worm   364 ------GGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHP-LGHILATGSNDNNTKFWARNR- 420

  Fly   506 IRGAKLCVVKTHRKRQPMEMV----GVSQI-ITPHALPLFRQEKSRTSRKRMEKARMDPVKSQRP 565
                            |.:.|    |:|.. :..|.      :|.|..|....|..::..::.||
 Worm   421 ----------------PGDTVEDIFGLSNTNMIGHL------DKEREPRMAPPKPSIETQETYRP 463

  Fly   566 D 566
            |
 Worm   464 D 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 58/337 (17%)
WD40 180..497 CDD:295369 57/315 (18%)
WD40 repeat 185..227 CDD:293791 8/41 (20%)
WD40 repeat 233..268 CDD:293791 6/34 (18%)
WD40 repeat 273..329 CDD:293791 12/55 (22%)
WD40 repeat 337..374 CDD:293791 8/38 (21%)
WD40 repeat 382..419 CDD:293791 10/36 (28%)
WD40 repeat 427..469 CDD:293791 5/42 (12%)
WD40 repeat 475..497 CDD:293791 5/22 (23%)
pfs-2NP_001380152.1 WD40 135..417 CDD:238121 57/319 (18%)
WD40 repeat 136..173 CDD:293791 8/41 (20%)
WD40 repeat 179..215 CDD:293791 6/48 (13%)
WD40 repeat 220..256 CDD:293791 11/41 (27%)
WD40 repeat 263..300 CDD:293791 8/41 (20%)
WD40 repeat 306..342 CDD:293791 10/36 (28%)
WD40 repeat 348..385 CDD:293791 5/42 (12%)
WD40 repeat 392..416 CDD:293791 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.