DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and gpb-1

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_001366714.1 Gene:gpb-1 / 174803 WormBaseID:WBGene00001679 Length:340 Species:Caenorhabditis elegans


Alignment Length:292 Identity:61/292 - (20%)
Similarity:108/292 - (36%) Gaps:87/292 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 DDYSSDEDSDDEQSLAKRIPYTHEVQMQHGSRAVLALAGDPSGARLVSGSIDYDMCFWDFAGMDS 216
            |.|::::              .|.:.::  |..|:..|..|||:.:..|.:|.....:.....:.
 Worm    83 DSYTTNK--------------VHAIPLR--SSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREG 131

  Fly   217 SMRSFRQLQPCENHPIRSLQYSVTGDMILVISGNAQAKVLDRDGFEKLECCKGDQYISDMSRTKG 281
            ::|..|:|   ..|         ||                     .|.||:   ::.|      
 Worm   132 NVRVSREL---PGH---------TG---------------------YLSCCR---FLDD------ 154

  Fly   282 HVAQLTSGCWHPFNREQFLTAALDGTLRIWQGLKSKEQLQVIKTRAQGGLRTNAASCNFNRDATL 346
                           .|.:|::.|.|..:|. :::.:|.... |...|.:.:.:.|.:|.   |.
 Worm   155 ---------------NQIVTSSGDMTCALWD-IETGQQCTAF-TGHTGDVMSLSLSPDFR---TF 199

  Fly   347 IAAGCVDGSIQTWDTRKMFVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQF 411
            |:..| |.|.:.||.|......|.   ..|:  |:|.::.|...|...||.|:|.|.:|:|:|..
 Worm   200 ISGAC-DASAKLWDIRDGMCKQTF---PGHE--SDINAVAFFPSGNAFATGSDDATCRLFDIRAD 258

  Fly   412 KQ-PLHTWTNLFSRYDTTDCCFSPDDRLLVTG 442
            :: .:::..|:..  ..|...||...|||..|
 Worm   259 QELAMYSHDNIIC--GITSVAFSKSGRLLFAG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 59/272 (22%)
WD40 180..497 CDD:295369 58/264 (22%)
WD40 repeat 185..227 CDD:293791 10/41 (24%)
WD40 repeat 233..268 CDD:293791 4/34 (12%)
WD40 repeat 273..329 CDD:293791 8/55 (15%)
WD40 repeat 337..374 CDD:293791 11/36 (31%)
WD40 repeat 382..419 CDD:293791 11/37 (30%)
WD40 repeat 427..469 CDD:293791 7/16 (44%)
WD40 repeat 475..497 CDD:293791
gpb-1NP_001366714.1 WD40 48..340 CDD:238121 61/292 (21%)
WD40 repeat 58..95 CDD:293791 3/25 (12%)
WD40 repeat 101..141 CDD:293791 9/42 (21%)
WD40 repeat 146..181 CDD:293791 10/60 (17%)
WD40 repeat 188..223 CDD:293791 11/41 (27%)
WD40 repeat 229..265 CDD:293791 11/35 (31%)
WD40 repeat 273..309 CDD:293791 7/16 (44%)
WD40 repeat 315..339 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.