DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and AgaP_AGAP008233

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_317237.3 Gene:AgaP_AGAP008233 / 1277747 VectorBaseID:AGAP008233 Length:168 Species:Anopheles gambiae


Alignment Length:174 Identity:77/174 - (44%)
Similarity:104/174 - (59%) Gaps:19/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQRGKISFGKIKLNVNVPPAEPRSNETEAEDAKESTEASGNG-GGFKKMDKEQMIRQIEDVAEDL 64
            |.||||:||||.|..:.|.:   |....||....||||:.:| |.|.:.|..| ...:|.::.:|
Mosquito     1 MNRGKITFGKINLKSSTPTS---STNDSAEIPSTSTEATVSGFGSFGRKDNAQ-DEAVERISAEL 61

  Fly    65 ESQHLKEVMGISGFGRKAAKVFDINEQIEKARVTRP--GMDKKR-----EESKPKEDDQKDEEEE 122
            ::..|:|||||||||||.||.|||||.|:||:...|  .:|:|.     :|.|.|:||..|||||
Mosquito    62 DNSKLQEVMGISGFGRKQAKQFDINEMIQKAKQNAPKAAVDEKAIIDPDDERKGKDDDDDDEEEE 126

  Fly   123 --DVIGPLPPAV---TTDKEKATKESSKDEDSDDDDYSSDEDSD 161
              ::|||:|.|.   .||..:  |::.|:||..|||...||:.|
Mosquito   127 EDEMIGPVPTAAGGGATDSRR--KKADKEEDDSDDDDDDDEEDD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201
WD40 180..497 CDD:295369
WD40 repeat 185..227 CDD:293791
WD40 repeat 233..268 CDD:293791
WD40 repeat 273..329 CDD:293791
WD40 repeat 337..374 CDD:293791
WD40 repeat 382..419 CDD:293791
WD40 repeat 427..469 CDD:293791
WD40 repeat 475..497 CDD:293791
AgaP_AGAP008233XP_317237.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 262 1.000 Domainoid score I4555
eggNOG 1 0.900 - - E1_KOG0772
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D177718at33208
OrthoFinder 1 1.000 - - FOG0005020
OrthoInspector 1 1.000 - - otm51124
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4081
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.