DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and ERCC8

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_000073.1 Gene:ERCC8 / 1161 HGNCID:3439 Length:396 Species:Homo sapiens


Alignment Length:374 Identity:62/374 - (16%)
Similarity:106/374 - (28%) Gaps:140/374 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 LQPCENHPIRSLQYSVTG--DMILVISGNAQAKVLDRDGFEKLECCKGDQYIS----DMSRTKGH 282
            ::|.|.      :|.::|  |.::|:..      |:....:....||....|.    |:.|....
Human    51 IEPVEG------RYMLSGGSDGVIVLYD------LENSSRQSYYTCKAVCSIGRDHPDVHRYSVE 103

  Fly   283 VAQLTSGCWHPFNREQFLTAALDGTLRIW----------------------QGLKSKEQLQVIKT 325
            ..|     |:|.:...|.:::.|.||::|                      ..:.:|..|..:.|
Human   104 TVQ-----WYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGT 163

  Fly   326 RA-----------------QGGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRKM--------- 364
            |.                 ||..:...|.....|...::|....|..::.||.|:.         
Human   164 RGPKVQLCDLKSGSCSHILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQ 228

  Fly   365 ----------FVNTTHCVRDAHQKGSEITSIVFSYMGQQLATRSNDETMKLWDLRQFKQPLHTW- 418
                      ..||.|        ..::..:.|:..|..|.|...|..|:||:....:..|..: 
Human   229 HNGKKSQAVESANTAH--------NGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYG 285

  Fly   419 ------------------------------------------TNLFSRYDTTDCCFSPDDRLLVT 441
                                                      |.|...|.|.|||....:     
Human   286 KVCNNSKKGLKFTVSCGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSN----- 345

  Fly   442 GESLPKGQAEANLYFYSTKSYEEVQRIPVSNAHVVKTLWHPKLNQLFVS 490
            .:.|..|..:.|:..:....||.|   |..:....|:..:|.....:.|
Human   346 FQELYSGSRDCNILAWVPSLYEPV---PDDDETTTKSQLNPAFEDAWSS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 62/374 (17%)
WD40 180..497 CDD:295369 62/374 (17%)
WD40 repeat 185..227 CDD:293791 0/2 (0%)
WD40 repeat 233..268 CDD:293791 5/36 (14%)
WD40 repeat 273..329 CDD:293791 15/98 (15%)
WD40 repeat 337..374 CDD:293791 9/55 (16%)
WD40 repeat 382..419 CDD:293791 9/79 (11%)
WD40 repeat 427..469 CDD:293791 10/41 (24%)
WD40 repeat 475..497 CDD:293791 3/16 (19%)
ERCC8NP_000073.1 WD 1 33..73 6/33 (18%)
WD40 40..361 CDD:421866 55/339 (16%)
WD40 repeat 47..97 CDD:293791 10/57 (18%)
WD 2 88..129 11/45 (24%)
WD40 repeat 102..141 CDD:293791 8/43 (19%)
WD 3 133..173 4/39 (10%)
WD40 repeat 145..183 CDD:293791 4/37 (11%)
WD 4 177..216 7/38 (18%)
WD40 repeat 189..227 CDD:293791 7/37 (19%)
WD 5 235..274 11/46 (24%)
WD 6 281..321 1/39 (3%)
WD40 repeat 295..331 CDD:293791 1/35 (3%)
WD 7 325..363 10/42 (24%)
WD40 repeat 336..361 CDD:293791 7/29 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..396 3/21 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.