DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5543 and ddb2

DIOPT Version :9

Sequence 1:NP_611832.1 Gene:CG5543 / 37768 FlyBaseID:FBgn0034908 Length:655 Species:Drosophila melanogaster
Sequence 2:XP_005159091.1 Gene:ddb2 / 100004133 ZFINID:ZDB-GENE-050419-169 Length:503 Species:Danio rerio


Alignment Length:499 Identity:99/499 - (19%)
Similarity:161/499 - (32%) Gaps:164/499 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 SMRSF----------RQLQPCENHPIRSLQYSV---TGDMILVISGNAQAKVLDRDGFEKLECCK 268
            |::|:          |::...|.||......:|   .||:||          .|.|...|....:
Zfish    99 SLKSYKLHRTASPFDRRVTSLEWHPTHPTTVAVGSKGGDIIL----------WDYDVLNKTSFIQ 153

  Fly   269 G---DQYISDMSRTKGHVAQLTSGCWHPFNREQFLTAALDGTLRI--WQGLKSKEQLQVIKTRAQ 328
            |   ..:|..|.             :.|.:..:...|:.|||:.:  ::||:|:           
Zfish   154 GKGAGDFIGGMK-------------FCPRDSSKVFVASGDGTVSVQSFEGLQSQ----------- 194

  Fly   329 GGLRTNAASCNFNRDATLIAAGCVDGSIQTWDTRKMFVNTTHCVR------DAHQ------KGSE 381
              :.:....|..:.........|||.|:    :|:|........|      |.|:      ..::
Zfish   195 --ILSRTPDCGHDHHDLCYWYCCVDVSV----SRQMLATGDSTGRLLLLGLDGHEIFKEKLHKAK 253

  Fly   382 ITSIVFSYMGQQL-ATRSNDETMKLWDLRQFKQPLHTWTNLFSRYDTTDCCFSPDD--RLLVTGE 443
            :|...|:.....| ||.|.|.|:||||||..|........:..........|:|.|  :||.|.:
Zfish   254 VTHAEFNPRCDWLMATSSVDATVKLWDLRNIKDKNSYIAEMPHEKPVNAAYFNPTDSTKLLTTDQ 318

  Fly   444 SLPKGQAEANLYFYSTKSYEEVQRIPVSNAH-------VVKTLWHPKL----------NQLFVSC 491
                   ...:..||:..:.:..:| :.:.|       .:|..|||..          :||.:: 
Zfish   319 -------RNEIRVYSSYDWSKPDQI-IIHPHRQFQHLTPIKATWHPMYDLIVAGRYPDDQLLLN- 374

  Fly   492 GNGTIKCYYDEHRSIRGAKLCVVKTHRKRQPMEMVGVSQIITPHALPLFRQEKSRTSRKRMEKA- 555
            ...||..|......:                     |.|:..|:|..:....|...:...:... 
Zfish   375 DKRTIDIYDANSGGL---------------------VHQLRDPNAAGIISLNKFSPTGDVLASGM 418

  Fly   556 --------RMDPVKSQRPDLPITSGQ--GGRVASSGGTLSSYVIRNLGLSKRVDDDQDPREAILK 610
                    |.|.:.|......|.:|:  |||...|....||        .:|...|:       :
Zfish   419 GFNILIWNREDTLSSVNRKQTIVTGEDVGGRAGGSRSQRSS--------QQRPSRDR-------R 468

  Fly   611 YAKDAAENPYWIAPAYKQTQPKAIFSEKLPADEPATK-KPKTEA 653
            .|.|.|:                 ..:||.|.|..:| |.|||:
Zfish   469 AAADEAK-----------------LKKKLSATETKSKTKSKTES 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5543NP_611832.1 WD40 <172..519 CDD:225201 69/351 (20%)
WD40 180..497 CDD:295369 67/329 (20%)
WD40 repeat 185..227 CDD:293791 3/19 (16%)
WD40 repeat 233..268 CDD:293791 8/37 (22%)
WD40 repeat 273..329 CDD:293791 10/57 (18%)
WD40 repeat 337..374 CDD:293791 8/42 (19%)
WD40 repeat 382..419 CDD:293791 15/37 (41%)
WD40 repeat 427..469 CDD:293791 8/43 (19%)
WD40 repeat 475..497 CDD:293791 7/31 (23%)
ddb2XP_005159091.1 WD40 64..>437 CDD:225201 77/407 (19%)
WD40 105..426 CDD:295369 72/390 (18%)
WD40 repeat 116..156 CDD:293791 12/49 (24%)
WD40 repeat 162..203 CDD:293791 9/66 (14%)
WD40 repeat 213..246 CDD:293791 9/36 (25%)
WD40 repeat 255..293 CDD:293791 15/37 (41%)
WD40 repeat 300..338 CDD:293791 9/45 (20%)
WD40 repeat 346..390 CDD:293791 9/65 (14%)
WD40 repeat 401..425 CDD:293791 1/23 (4%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.