Sequence 1: | NP_523830.2 | Gene: | Ssrp / 37767 | FlyBaseID: | FBgn0010278 | Length: | 723 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001350372.1 | Gene: | Hmgb2 / 97165 | MGIID: | 96157 | Length: | 210 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 65/206 - (31%) |
---|---|---|---|
Similarity: | 90/206 - (43%) | Gaps: | 58/206 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 521 KKEKKSEKKEKKEKKHKEKE-RTKKPSK-----KKKDSGKPKRATTAFMLWLNDTRESIKRENPG 579
Fly 580 IKVTEIAKKGGEMWKE--LKDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKT 642
Fly 643 EPSPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSESEPEESE 707
Fly 708 EDSNASDEDEE 718 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ssrp | NP_523830.2 | POB3 | 20..499 | CDD:227494 | |
SSrecog | 75..284 | CDD:281523 | |||
PH2_SSRP1-like | 332..427 | CDD:270051 | |||
HMG_box | 557..620 | CDD:278906 | 27/64 (42%) | ||
Hmgb2 | NP_001350372.1 | HMG-box | 7..78 | CDD:320749 | 6/22 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..102 | 10/30 (33%) | |||
HMG_box | 95..162 | CDD:278906 | 29/66 (44%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 162..210 | 22/97 (23%) | |||
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 | 165..180 | 5/20 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |