DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and HMGB2

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_564123.1 Gene:HMGB2 / 838658 AraportID:AT1G20693 Length:144 Species:Arabidopsis thaliana


Alignment Length:214 Identity:55/214 - (25%)
Similarity:80/214 - (37%) Gaps:82/214 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   517 GAKKKKEKKSEKKEKKEKKHKEKERTKKPSK-------KKKDSGKPKRATTAFMLWLNDTRESIK 574
            |||.|.|.:|.|...          ||||:|       ..||..||||..:||.:::.|.||:.|
plant     3 GAKSKTETRSSKLSV----------TKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFK 57

  Fly   575 RENPGIK-VTEIAKKGGEMWKELKD--KSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKS 636
            :|||..| |..:.|..|:.||.|.|  |:.:...|.|.|..|...::.|                
plant    58 KENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAY---------------- 106

  Fly   637 SKKRKTEPSPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSES 701
              .:|.|..|.:                       |:|.|                     ||.|
plant   107 --NKKLEEGPKE-----------------------DEESD---------------------KSVS 125

  Fly   702 EPEESEEDSNASDEDEEDE 720
            |..:.::..:.|:|:|:|:
plant   126 EVNDEDDAEDGSEEEEDDD 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 23/65 (35%)
HMGB2NP_564123.1 HMG_box 38..106 CDD:395407 25/67 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I3986
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.