DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and hmg20a

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001006760.1 Gene:hmg20a / 448440 XenbaseID:XB-GENE-955353 Length:345 Species:Xenopus tropicalis


Alignment Length:191 Identity:45/191 - (23%)
Similarity:84/191 - (43%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 LKAEAREKEEDDDDGDSDEESTDEDFKPNENESDVAEEYDSNVESDSDDDSDASGGGGDSDGAKK 520
            |..:.:|..|....|.|...|:...|.| ::.:...:|.|..:...|.:....:.|         
 Frog    15 LVVDTKENAEPPFCGISLSGSSQAPFHP-QSPTLQQDERDELILQQSGEQQLGNSG--------- 69

  Fly   521 KKEKKSEKKEKKEKK---HKEKERTKKPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIKV 582
              |.:.|::..|.::   .|.::|.:.|    :|:..||...|.::.::|:.||.::.|.|.:..
 Frog    70 --ELRQEEELPKTRRGGWTKGRKRKRSP----RDNNAPKAPLTGYVRFMNERREQLRTERPDVPF 128

  Fly   583 TEIAKKGGEMWKEL--KDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRK 641
            .||.:..|..|.:|  .:|..:.|.|.|||:||..|::.|:......:.:.|.....|.|:
 Frog   129 PEITRIVGSEWSKLPAHEKQHYLDEAEKDKERYTKELQQYQNTDAYQTYSRKAQSRQKGRQ 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494 10/42 (24%)
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 20/64 (31%)
hmg20aNP_001006760.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..124 26/124 (21%)
NHP6B 48..>181 CDD:227935 34/147 (23%)
HMGB-UBF_HMG-box 101..166 CDD:238686 22/64 (34%)
SMC_prok_A <141..322 CDD:274009 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..198 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.