DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and hmgb1

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_989226.1 Gene:hmgb1 / 394834 XenbaseID:XB-GENE-1001206 Length:211 Species:Xenopus tropicalis


Alignment Length:208 Identity:66/208 - (31%)
Similarity:91/208 - (43%) Gaps:59/208 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 KKEKKSEKKEKKEKKHKEKE-RTKKP-----SKKKKDSGKPKRATTAFMLWLNDTRESIKRENPG 579
            |::.|.|...|.:|...|:| :|..|     .||.||...|||..:||.|:.::.|..||.|:||
 Frog    55 KEKSKFEDMAKADKVRYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEFRPKIKGEHPG 119

  Fly   580 IKVTEIAKKGGEMWKE--LKDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKT 642
            ..:.:||||.||||..  ..||..:|..|||.|::|..::..|                  :.|.
 Frog   120 STIGDIAKKLGEMWNNTATDDKLPYERKAAKLKEKYEKDVAAY------------------RAKG 166

  Fly   643 EPSPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSESEPEESE 707
            :|.|:|||.......|.||   |||    |||.|:                          :|.|
 Frog   167 KPEPAKKAPAKFEKAKKKE---DDD----DDEDDD--------------------------DEEE 198

  Fly   708 EDSNASDEDEEDE 720
            ||....||:::||
 Frog   199 EDEEEEDEEDDDE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 26/64 (41%)
hmgb1NP_989226.1 HMG_box_2 6..78 CDD:370242 7/22 (32%)
HMG_box 95..162 CDD:366139 28/66 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.