DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and HMGB2

DIOPT Version :10

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_002120.1 Gene:HMGB2 / 3148 HGNCID:5000 Length:209 Species:Homo sapiens


Alignment Length:211 Identity:64/211 - (30%)
Similarity:90/211 - (42%) Gaps:66/211 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 KKEKKSEKKEKKEKKHKEKE-RTKKPSK-----KKKDSGKPKRATTAFMLWLNDTRESIKRENPG 579
            |::.|.|...|.:|...::| :...|.|     ||||...|||..:||.|:.::.|..||.|:||
Human    55 KEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPG 119

  Fly   580 IKVTEIAKKGGEMWKE--LKDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKT 642
            :.:.:.|||.||||.|  .|||..:|..|||.|::|..::..|:  |.|.|:      :.||...
Human   120 LSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYR--AKGKSE------AGKKGPG 176

  Fly   643 EPSPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSESEPEESE 707
            .|:.|||.|                                                  |||:.|
Human   177 RPTGSKKKN--------------------------------------------------EPEDEE 191

  Fly   708 EDSNASDEDEEDEASD 723
            |:....|||||:|..|
Human   192 EEEEEEDEDEEEEDED 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
HMG-box_SSRP1-like 557..621 CDD:438810 27/65 (42%)
HMGB2NP_002120.1 HMG-box_HMGB_rpt1 8..76 CDD:438794 6/20 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..150 37/94 (39%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 29/69 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..209 23/104 (22%)
Required for chemotactic activity. /evidence=ECO:0000269|PubMed:19811285 165..180 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.