DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and hmg-1.1

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001370073.1 Gene:hmg-1.1 / 175081 WormBaseID:WBGene00001971 Length:95 Species:Caenorhabditis elegans


Alignment Length:88 Identity:41/88 - (46%)
Similarity:54/88 - (61%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 KKHKEKERTKKPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKD 598
            ||....:|.|| ..|.||...||||.:||..|:.:.||.||:  ||:.|.::||..|..|.:|.|
 Worm     8 KKASPVKRVKK-GGKAKDPNAPKRAMSAFFFWMQENRERIKK--PGMGVADVAKAAGVEWGKLTD 69

  Fly   599 KSKWEDAAAKDKQRYHDEMRNYK 621
            ||:||..||.||:||..::.|||
 Worm    70 KSRWEKKAADDKKRYEVDIANYK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 28/62 (45%)
hmg-1.1NP_001370073.1 HMGB-UBF_HMG-box 28..89 CDD:238686 30/62 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I6068
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.