DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and hmg-1.1

DIOPT Version :10

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001370073.1 Gene:hmg-1.1 / 175081 WormBaseID:WBGene00001971 Length:95 Species:Caenorhabditis elegans


Alignment Length:88 Identity:41/88 - (46%)
Similarity:54/88 - (61%) Gaps:3/88 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 KKHKEKERTKKPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKD 598
            ||....:|.|| ..|.||...||||.:||..|:.:.||.||:  ||:.|.::||..|..|.:|.|
 Worm     8 KKASPVKRVKK-GGKAKDPNAPKRAMSAFFFWMQENRERIKK--PGMGVADVAKAAGVEWGKLTD 69

  Fly   599 KSKWEDAAAKDKQRYHDEMRNYK 621
            ||:||..||.||:||..::.|||
 Worm    70 KSRWEKKAADDKKRYEVDIANYK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
HMG-box_SSRP1-like 557..621 CDD:438810 29/63 (46%)
hmg-1.1NP_001370073.1 HMG-box_SF 15..91 CDD:469606 36/78 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.