Sequence 1: | NP_523830.2 | Gene: | Ssrp / 37767 | FlyBaseID: | FBgn0010278 | Length: | 723 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001280552.1 | Gene: | Hmgb3 / 15354 | MGIID: | 1098219 | Length: | 200 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 60/206 - (29%) |
---|---|---|---|
Similarity: | 86/206 - (41%) | Gaps: | 66/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 521 KKEKKSEKKEKKEKKHKEKER----TKKPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIK 581
Fly 582 VTEIAKKGGEMWKELKDKSK--WEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKTEP 644
Fly 645 SPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSESEPEESEED 709
Fly 710 SNASDEDEEDE 720 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ssrp | NP_523830.2 | POB3 | 20..499 | CDD:227494 | |
SSrecog | 75..284 | CDD:281523 | |||
PH2_SSRP1-like | 332..427 | CDD:270051 | |||
HMG_box | 557..620 | CDD:278906 | 25/64 (39%) | ||
Hmgb3 | NP_001280552.1 | HMG_box_2 | 13..78 | CDD:370242 | 5/22 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 71..97 | 10/25 (40%) | |||
HMG_box | 93..160 | CDD:366139 | 27/66 (41%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..200 | 19/98 (19%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |