DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and Hmgb3

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001280552.1 Gene:Hmgb3 / 15354 MGIID:1098219 Length:200 Species:Mus musculus


Alignment Length:206 Identity:60/206 - (29%)
Similarity:86/206 - (41%) Gaps:66/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 KKEKKSEKKEKKEKKHKEKER----TKKPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIK 581
            |::.|.::..|.:|...::|.    ..|..|||||...|||..:.|.|:.::.|..||..||||.
Mouse    55 KEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGIS 119

  Fly   582 VTEIAKKGGEMWKELKDKSK--WEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKTEP 644
            :.::|||.||||..|.|..|  :...|||.|::|..::.:||.:  |..|..||           
Mouse   120 IGDVAKKLGEMWNNLSDNEKQPYVTKAAKLKEKYEKDVADYKSK--GKFDGAKG----------- 171

  Fly   645 SPSKKANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKSKPPSDGDAKKKKAKSESEPEESEED 709
                                              |||          ..:||.:.|.|.||.||:
Mouse   172 ----------------------------------PAK----------VARKKVEEEEEEEEEEEE 192

  Fly   710 SNASDEDEEDE 720
               .:|:||||
Mouse   193 ---EEEEEEDE 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 25/64 (39%)
Hmgb3NP_001280552.1 HMG_box_2 13..78 CDD:370242 5/22 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..97 10/25 (40%)
HMG_box 93..160 CDD:366139 27/66 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.