Sequence 1: | NP_523830.2 | Gene: | Ssrp / 37767 | FlyBaseID: | FBgn0010278 | Length: | 723 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138203.1 | Gene: | Dsp1 / 117294 | FlyBaseID: | FBgn0278608 | Length: | 397 | Species: | Drosophila melanogaster |
Alignment Length: | 289 | Identity: | 63/289 - (21%) |
---|---|---|---|
Similarity: | 105/289 - (36%) | Gaps: | 74/289 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 445 NENEPDAYLARLKAEAREKEEDDDDGDSDEESTDEDFKPNENESDVAEEYD--SNVESDSDDDSD 507
Fly 508 ASGGGGDSDGAKKKKEKK------------------------SEKKEKKEKKHKEKERTK----- 543
Fly 544 ------------KPSKKKKDSGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKEL 596
Fly 597 --KDKSKWEDAAAKDKQRYHDEMRNYKPEAGGDSDNEKGGKSSKKRKTEPSPSKKANTSGSGFKS 659
Fly 660 --------------KEYISDDDSTSSDDE 674 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ssrp | NP_523830.2 | POB3 | 20..499 | CDD:227494 | 6/55 (11%) |
SSrecog | 75..284 | CDD:281523 | |||
PH2_SSRP1-like | 332..427 | CDD:270051 | |||
HMG_box | 557..620 | CDD:278906 | 25/64 (39%) | ||
Dsp1 | NP_001138203.1 | HMG-box | 182..252 | CDD:294061 | 9/69 (13%) |
HMGB-UBF_HMG-box | 275..339 | CDD:238686 | 25/63 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45450768 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |