DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ssrp and HMG20A

DIOPT Version :9

Sequence 1:NP_523830.2 Gene:Ssrp / 37767 FlyBaseID:FBgn0010278 Length:723 Species:Drosophila melanogaster
Sequence 2:NP_001291433.1 Gene:HMG20A / 10363 HGNCID:5001 Length:347 Species:Homo sapiens


Alignment Length:230 Identity:59/230 - (25%)
Similarity:103/230 - (44%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 DGDSDEESTDEDFKPNENESDVAEEYDSNVESDSDDD---SDASGGGGDSDGAKKKKEKKSEKKE 530
            |.|..:||.|. .....|..:|  .|.|...|.:::.   .|.|.|       :..:.:.|...|
Human    16 DEDGSKESNDL-ATTGLNHPEV--PYSSGATSSTNNPEFVEDLSQG-------QLLQSESSNAAE 70

  Fly   531 KKEKKHKEKERTK-----KPSKKKK---DSGKPKRATTAFMLWLNDTRESIKRENPGIKVTEIAK 587
            ..|::|::::|:|     |..|:||   ||..||...|.::.::|:.||.::.:.|.:...||.:
Human    71 GNEQRHEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITR 135

  Fly   588 KGGEMWKEL--KDKSKWEDAAAKDKQRYHDEMRNY-KPEAGGDSDNEKGGKSSKKRKTEPSPSKK 649
            ..|..|.:|  ::|.::.|.|.:||:||..|:..| |.||          .....|||:.....|
Human   136 MLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEA----------YKVFSRKTQDRQKGK 190

  Fly   650 ANTSGSGFKSKEYISDDDSTSSDDEKDNEPAKKKS 684
            ::...:..::          :.|.||:.| .|::|
Human   191 SHRQDAARQA----------THDHEKETE-VKERS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SsrpNP_523830.2 POB3 20..499 CDD:227494 9/29 (31%)
SSrecog 75..284 CDD:281523
PH2_SSRP1-like 332..427 CDD:270051
HMG_box 557..620 CDD:278906 18/64 (28%)
HMG20ANP_001291433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113 28/106 (26%)
DUF5401 <59..313 CDD:375164 46/177 (26%)
HMGB-UBF_HMG-box 103..168 CDD:238686 20/64 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..211 8/42 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.