DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and HVA22C

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_177128.1 Gene:HVA22C / 843306 AraportID:AT1G69700 Length:184 Species:Arabidopsis thaliana


Alignment Length:120 Identity:29/120 - (24%)
Similarity:49/120 - (40%) Gaps:18/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAWQTYKTLNS----GDEEFLAWAKYWIVYAFLVTFEVLADVFLSWLPLYMPTKLLLVVWIVLSA 80
            |.:.:.|.:.:    .||:   |..||::||.:..||:.....|.|.|::...||..:.|:||..
plant    31 PLYASVKAIETRSLPEDEQ---WLTYWVLYALISLFELTFSKPLEWFPIWPYMKLFGICWLVLPQ 92

  Fly    81 PAANVWIFDAILRPVLAKRQ-----------EEIDHFLHRGKEKLLIDALASMTQ 124
            ......|:...:||.....|           ::.:.|..|..:.:|..|...|.|
plant    93 FNGAEHIYKHFIRPFYRDPQRATTKIWYVPHKKFNFFPKRDDDDILTAAEKYMEQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 20/77 (26%)
HVA22CNP_177128.1 TB2_DP1_HVA22 31..107 CDD:460820 21/78 (27%)

Return to query results.
Submit another query.