DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and HVA22E

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_568744.1 Gene:HVA22E / 835144 AraportID:AT5G50720 Length:116 Species:Arabidopsis thaliana


Alignment Length:77 Identity:23/77 - (29%)
Similarity:42/77 - (54%) Gaps:6/77 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DEEFLAWAKYWIVYAFLVTFEVLADVFLSWLPLYMPTKLLLVVWIVLSAPAANVWIFDAILRPVL 96
            ||:   |..|||:|:||...|::....|.|:|::...||:.|.|:||.......:|::.::|...
plant    40 DEQ---WLAYWILYSFLTLSELILQSLLEWIPIWYTAKLVFVAWLVLPQFRGAAFIYNKVVREQF 101

  Fly    97 AK---RQEEIDH 105
            .|   .:.:::|
plant   102 KKYGILKPKVEH 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 20/61 (33%)
HVA22ENP_568744.1 TB2_DP1_HVA22 24..98 CDD:460820 20/60 (33%)

Return to query results.
Submit another query.