DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and HVA22D

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_567713.1 Gene:HVA22D / 828598 AraportID:AT4G24960 Length:135 Species:Arabidopsis thaliana


Alignment Length:94 Identity:26/94 - (27%)
Similarity:47/94 - (50%) Gaps:6/94 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLVSQFLFFVYGTMGPAWQTYKTLNSGDEEFLAWAKYWIVYAFLVTFEVLADVFLSWLPLYMPTK 69
            |.:...|:.:|.::.....|.|.    |:|  .|..|||:|:||...|::....:.|:|::...|
plant    16 GPIVMLLYPLYASVIAMESTTKV----DDE--QWLAYWIIYSFLSLTELILQSLIEWIPIWYTVK 74

  Fly    70 LLLVVWIVLSAPAANVWIFDAILRPVLAK 98
            |:.|.|:||.......:|::.::|....|
plant    75 LVFVAWLVLPQFQGAAFIYNRVVREQFKK 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 21/73 (29%)
HVA22DNP_567713.1 TB2_DP1_HVA22 24..98 CDD:460820 22/79 (28%)

Return to query results.
Submit another query.