DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and Reep5

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001102358.2 Gene:Reep5 / 364838 RGDID:1306047 Length:189 Species:Rattus norvegicus


Alignment Length:129 Identity:36/129 - (27%)
Similarity:64/129 - (49%) Gaps:13/129 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GLVSQFLFFVYGT------MG---PAWQTYKTLNS-GDEEFLAWAKYWIVYAFLVTFEVLADVFL 59
            |||:.:|.|.||.      :|   ||:.:.|.:.| ..::...|..||:||......|..:|:||
  Rat    43 GLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFL 107

  Fly    60 SWLPLYMPTKLLLVVWIVLSAPAANV-WIFDAILRPVLAKRQEEIDHFLH--RGKEKLLIDALA 120
            ||.|.|...|...::|.:..:|:... .::..::||:..|.:.::|..:.  :.|.|...||::
  Rat   108 SWFPFYYMLKCGFLLWCMAPSPSNGAELLYRRVIRPIFLKHESQVDSVVKDVKDKAKETADAIS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 20/75 (27%)
Reep5NP_001102358.2 TB2_DP1_HVA22 67..144 CDD:460820 21/76 (28%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000250|UniProtKB:Q00765 114..185 11/58 (19%)

Return to query results.
Submit another query.