DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and Reep6

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001013236.1 Gene:Reep6 / 362835 RGDID:1309508 Length:211 Species:Rattus norvegicus


Alignment Length:146 Identity:38/146 - (26%)
Similarity:64/146 - (43%) Gaps:15/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGLVSQFLFFVYGTMGPAWQTYKTLNS-GDEEFLAWAKYWIVYAFLVTFEVLADVFLSWLPLYMP 67
            ||..:..|..|.|.:.||:.:.|.:.| ..|:...|..||:|||.....|..:|:.|.|.|.|..
  Rat    50 FGYGASLLCNVIGFVYPAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYA 114

  Fly    68 TKLLLVVWIVLSAPAANVW-----IFDAILRPVLAKRQEEIDHFLHRGKEKLLIDALASMT---- 123
            .|...:::.:...|    |     ::..::||:..|....:|....:...:.| |..|.:|    
  Rat   115 GKCAFLLFCMTPGP----WNGALLLYHRVIRPLFLKHHVALDSAASQLSGRAL-DIAAGITRDVL 174

  Fly   124 QLVAQTQISVLPFVSS 139
            |.:|:.:..|.|..:|
  Rat   175 QALARGRTLVTPASAS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 20/79 (25%)
Reep6NP_001013236.1 TB2_DP1_HVA22 66..143 CDD:460820 21/80 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..211 1/3 (33%)

Return to query results.
Submit another query.