DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and reep5

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_956352.1 Gene:reep5 / 337237 ZFINID:ZDB-GENE-030131-9181 Length:189 Species:Danio rerio


Alignment Length:104 Identity:32/104 - (30%)
Similarity:53/104 - (50%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVSQFLFFVYGTMGPAWQTYKTLNS-GDEEFLAWAKYWIVYAFLVTFEVLADVFLSWLPLYMPTK 69
            |:...:.|||    ||:.:.|.:.| ..::...|..||:||......|..||:||||.|.|...|
Zfish    57 LLCNLIGFVY----PAYISIKAIESPAKDDDTKWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAK 117

  Fly    70 LLLVVWIVLSAPA-ANVWIFDAILRPVLAKRQEEIDHFL 107
            ...:||.:...|: .::.::..|:||...|.:.:||:.:
Zfish   118 CAFLVWCMAPTPSNGSIMLYTRIIRPFFLKNEAKIDNVM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 23/75 (31%)
reep5NP_956352.1 TB2_DP1_HVA22 67..144 CDD:460820 24/76 (32%)
Required for dimerization and maintaining endoplasmic reticulum morphology. /evidence=ECO:0000250|UniProtKB:Q00765 114..185 10/43 (23%)

Return to query results.
Submit another query.