DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and F56B3.6

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_499990.1 Gene:F56B3.6 / 176906 WormBaseID:WBGene00018930 Length:205 Species:Caenorhabditis elegans


Alignment Length:117 Identity:29/117 - (24%)
Similarity:55/117 - (47%) Gaps:14/117 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FGLVSQFLFFVYGTMG-----------PAWQTYKTLNS-GDEEFLAWAKYWIVYAFLVTFEVLAD 56
            |||::.||  |:|::.           |.:.:.|.:.| |.::...|..||..:|.|...:..::
 Worm    87 FGLIAFFL--VFGSVARLLCNLIGFGYPTYASVKAIRSPGGDDDTVWLIYWTCFAVLYLVDFFSE 149

  Fly    57 VFLSWLPLYMPTKLLLVVWIVLSAPAANVWIFDAILRPVLAKRQEEIDHFLH 108
            ..|||.|.|...|...:|::.|.....:|..::.|:.|::....:.:|.|.:
 Worm   150 AILSWFPFYYIAKACFLVYLYLPQTQGSVMFYETIVDPLVIFVDKNLDKFYY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 19/74 (26%)
F56B3.6NP_499990.1 TB2_DP1_HVA22 112..188 CDD:460820 19/75 (25%)

Return to query results.
Submit another query.