DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and C06E1.1

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_498893.1 Gene:C06E1.1 / 176205 WormBaseID:WBGene00015518 Length:161 Species:Caenorhabditis elegans


Alignment Length:106 Identity:23/106 - (21%)
Similarity:37/106 - (34%) Gaps:38/106 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FFGLVSQFLFFVYGTMGPAWQTYKTL----NSGDEEFLAWAKYWIVYAFLVTFEVLADVFLSWLP 63
            |..|.|..:...:    |..:::..|    |..|...|    |||:||.:..|:..|   |..:|
 Worm    60 FLPLFSHIICIFW----PVKESFMILRQQKNPSDNILL----YWILYAMVSLFDYSA---LPGVP 113

  Fly    64 LY--MPTKLLLVV---------------------WIVLSAP 81
            .|  ..|.|.|.:                     |::::.|
 Worm   114 FYYFAKTGLFLSITTNGFDKLKEWSEPALKFTETWVLVTPP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 20/89 (22%)
C06E1.1NP_498893.1 TB2_DP1_HVA22 73..>124 CDD:460820 17/57 (30%)

Return to query results.
Submit another query.