DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5539 and yop-1

DIOPT Version :10

Sequence 1:NP_611831.2 Gene:CG5539 / 37766 FlyBaseID:FBgn0034907 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_491033.1 Gene:yop-1 / 171835 WormBaseID:WBGene00022127 Length:183 Species:Caenorhabditis elegans


Alignment Length:106 Identity:28/106 - (26%)
Similarity:52/106 - (49%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FG----LVSQFLFFVYGTMGPAWQTYKTLNSGD-EEFLAWAKYWIVYAFLVTFEVLADVFLSWLP 63
            ||    ||..|:.|||    ||:.:.|.:.|.: |:...|..||:::|.|...|..:...::..|
 Worm    56 FGHSAQLVCNFMGFVY----PAYMSIKAIESSNKEDDTQWLTYWVIFAILSVVEFFSVQIVAVFP 116

  Fly    64 LYMPTKLLLVVWIVLSAPAANVWIFDAILRPVLAKRQEEID 104
            :|...|.:.::::.|.:......::...::||.|:....||
 Worm   117 VYWLFKSIFLLYLYLPSFLGAAKLYHRFVKPVAARHSGSID 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5539NP_611831.2 TB2_DP1_HVA22 20..94 CDD:460820 15/74 (20%)
yop-1NP_491033.1 TB2_DP1_HVA22 72..147 CDD:460820 15/74 (20%)

Return to query results.
Submit another query.