DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG34260

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001262120.1 Gene:CG34260 / 5740551 FlyBaseID:FBgn0085289 Length:178 Species:Drosophila melanogaster


Alignment Length:149 Identity:32/149 - (21%)
Similarity:48/149 - (32%) Gaps:43/149 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGY 82
            |:...|...::|||...:....|:           |:.||...|..:   .|.....|:||... 
  Fly    33 QIIAKAYVNSLECLLVRQRTAVVA-----------VKFSLNQTIEHF---DVLATFDLIKKDKS- 82

  Fly    83 KPFLYNIC--QSDVCEYLEK--RNHPFINIILSSFGNRTNVNKCPIPPEIVLEHFRFPVKVLDMM 143
               ..||.  :.|.|:||..  :|    ||:...|....:|:..|                 |..
  Fly    83 ---RMNIADIKIDGCKYLGSMYQN----NIVGKLFKRLKSVSNLP-----------------DSC 123

  Fly   144 PLPFGDYGLFTTFTFHRSE 162
            |:..|.......:||...|
  Fly   124 PVSKGKLYEIRNYTFISDE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 18/85 (21%)
CG34260NP_001262120.1 DUF1091 73..154 CDD:284008 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.