DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG14518

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:154 Identity:51/154 - (33%)
Similarity:87/154 - (56%) Gaps:4/154 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFL 86
            :.|.||..|.:.::::....||||.||.|:.|.:::.||:|. |...|.::.:|||:|:||||:|
  Fly    24 IFKMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYKPWL 87

  Fly    87 YNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPVKVLDMMPLPFGDY 150
            |:: ..|.|:::.:||:..|.|:...|...:.:| .||......:::|....:.|. .|:|.|:|
  Fly    88 YSV-SFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQQVKNFYLRSEKLP-TPIPTGEY 150

  Fly   151 GLFTTFTFHRSELAQVKVYFTLTE 174
            .|...:.|::...|...||||..|
  Fly   151 LLMIDWVFNKKPQAATNVYFTFVE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/91 (31%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 28/91 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471950
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.990

Return to query results.
Submit another query.