DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG14455

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:166 Identity:33/166 - (19%)
Similarity:60/166 - (36%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTELFLLFGLWHILQV-------QGVAKFTNIEC-LSADENFTTVSLCRLYAVK--RDVVEMSLR 58
            |..|..|.|.|...:|       :...||.:::. |..|...:.:|:    .:|  :|:.::.|.
  Fly    16 LVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSI----DIKTHQDIEDVQLV 76

  Fly    59 ANI-LRWPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRN-HPFINIILSS-FGNRTNVN 120
            .:. |...||..|   .|:.:...:            |:.:::|| .|.:..|... ..:.|...
  Fly    77 VDFGLETDKGNYS---TLINRTLNF------------CKLMKQRNSDPLVRAIYEDLLKHGTLFK 126

  Fly   121 KCPI-----------------PPEIVLEHFRFPVKV 139
            :|||                 |..:....|||.:|:
  Fly   127 ECPIRSGTYSLTNYNVDEEMLPSFLPEAKFRFGMKI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 14/77 (18%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/91 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.