DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG14455

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:166 Identity:33/166 - (19%)
Similarity:60/166 - (36%) Gaps:49/166 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTELFLLFGLWHILQV-------QGVAKFTNIEC-LSADENFTTVSLCRLYAVK--RDVVEMSLR 58
            |..|..|.|.|...:|       :...||.:::. |..|...:.:|:    .:|  :|:.::.|.
  Fly    16 LVALMPLTGAWRSFKVILTSIDFEANDKFLDLKVDLQNDSGESNLSI----DIKTHQDIEDVQLV 76

  Fly    59 ANI-LRWPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRN-HPFINIILSS-FGNRTNVN 120
            .:. |...||..|   .|:.:...:            |:.:::|| .|.:..|... ..:.|...
  Fly    77 VDFGLETDKGNYS---TLINRTLNF------------CKLMKQRNSDPLVRAIYEDLLKHGTLFK 126

  Fly   121 KCPI-----------------PPEIVLEHFRFPVKV 139
            :|||                 |..:....|||.:|:
  Fly   127 ECPIRSGTYSLTNYNVDEEMLPSFLPEAKFRFGMKI 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 14/77 (18%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 16/91 (18%)

Return to query results.
Submit another query.