DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG13250

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:54/163 - (33%) Gaps:47/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KFTNIECLSADENFTTVSLCRLYAVKRDVVEMS------------LRANILR-WPK---GPVSMR 72
            ::.:|.|...|.....:..|       |:|||.            ||.::.: |.:   |.::.|
  Fly    34 RWRDINCSVIDPTTAEIFKC-------DIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANR 91

  Fly    73 -----MQLLKKASGYKPFLYNICQSDVCEYLEKRNHP-FINIILSSF---GNRTNVNKCPIPPEI 128
                 .||.|            .:.|.|..:|.|:.. .:|.:|...   ||..:.  ||:...:
  Fly    92 KDRPVQQLFK------------IRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDA--CPLLANV 142

  Fly   129 VLEHFRFPVKVLDMMPLPFGDYGLFTTFTFHRS 161
            .....||.:.. |..|....|....|...|..|
  Fly   143 NYTSTRFALNP-DHFPAYMPDMKFNTKLVFQLS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 18/84 (21%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/95 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.