DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG13250

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:163 Identity:34/163 - (20%)
Similarity:54/163 - (33%) Gaps:47/163 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KFTNIECLSADENFTTVSLCRLYAVKRDVVEMS------------LRANILR-WPK---GPVSMR 72
            ::.:|.|...|.....:..|       |:|||.            ||.::.: |.:   |.::.|
  Fly    34 RWRDINCSVIDPTTAEIFKC-------DIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANR 91

  Fly    73 -----MQLLKKASGYKPFLYNICQSDVCEYLEKRNHP-FINIILSSF---GNRTNVNKCPIPPEI 128
                 .||.|            .:.|.|..:|.|:.. .:|.:|...   ||..:.  ||:...:
  Fly    92 KDRPVQQLFK------------IRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDA--CPLLANV 142

  Fly   129 VLEHFRFPVKVLDMMPLPFGDYGLFTTFTFHRS 161
            .....||.:.. |..|....|....|...|..|
  Fly   143 NYTSTRFALNP-DHFPAYMPDMKFNTKLVFQLS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 18/84 (21%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 21/95 (22%)

Return to query results.
Submit another query.