DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33721

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:183 Identity:54/183 - (29%)
Similarity:94/183 - (51%) Gaps:18/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATLTELFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPK 66
            |.|..|.:.||  :|::.....:|||.:|...|..:.:...|.:.:|.|....:||:||:...|.
  Fly     6 AKLFVLVIFFG--NIMENASKLEFTNFKCHVKDPTYLSFEYCFIKSVNRTYKYISLKANMYEVPI 68

  Fly    67 GPVSMRMQLLKKASGYKPFLYNICQS-DVCEYLE-KRN--HPFINIILSSFGNRTNVN-KCPIPP 126
            ...|.::|:.::...|.|.  .|..| |||:|:. |:|  :|.:.:........||.| |||...
  Fly    69 TNASAKLQISRRFRSYMPI--TIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCPYDH 131

  Fly   127 EIVLEHFRFPVKVL-----DMMPLPFGDYGLFTTFTFHRS-ELAQVKVYFTLT 173
            :::::  |.|.|.|     :::|||.|||. |.:..:.|: |.|.:.:|:|::
  Fly   132 DLIID--RLPSKYLSEHFTNILPLPPGDYS-FNSIWYSRNIERATISIYYTVS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 33/101 (33%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 28/90 (31%)

Return to query results.
Submit another query.