DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG12849

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:172 Identity:50/172 - (29%)
Similarity:80/172 - (46%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLWHIL-------QVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPV 69
            |||..|       .::|..:|.|:.||..|..|.....|.|.:|.|....:||:..:.|.|....
  Fly     3 GLWTFLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVDNC 67

  Fly    70 SMRMQLLKKASGYKPFLYNI-CQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEH 132
            ..|.||..:.:  :..|||. .:.|.|:::..|.|...|.:..:||..:|:| .||...:|||: 
  Fly    68 ETRFQLRMREN--RRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYDHDIVLD- 129

  Fly   133 FRFPVKVLDMMP---LPFGDYGLFTTFTFHRSELAQVKVYFT 171
             :.||:.|:.:.   :|.|.|.:.:|:.........|.:|||
  Fly   130 -KLPVQHLNKLVQSIIPDGRYMMNSTWMVAGIPRTDVILYFT 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 28/95 (29%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 28/93 (30%)

Return to query results.
Submit another query.