DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG13589

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_611918.2 Gene:CG13589 / 37906 FlyBaseID:FBgn0035011 Length:174 Species:Drosophila melanogaster


Alignment Length:155 Identity:53/155 - (34%)
Similarity:81/155 - (52%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFL 86
            :||.||..|.|.::::..|..|||.|..|....:::.|..:. |...:.:.|:::|||:||||||
  Fly    24 LAKMTNAVCKSYNKSWVVVHYCRLKAYSRTKTSLNINATFIE-PAKNIYLHMKMMKKANGYKPFL 87

  Fly    87 YNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPVKVLDM-MPLPFGD 149
            ::. ..|.||::.:||.||..|:.:...|.:.|| .||.....:|..|..    :|: :|||.||
  Fly    88 FDY-TFDACEFMRRRNQPFAKIVWNMIKNVSTVNHTCPYEGLQMLSDFHH----IDVPVPLPSGD 147

  Fly   150 YGLFTTFTFHRSELAQVKVYFTLTE 174
            |.|...:.|.........||||..|
  Fly   148 YLLLLDWIFDFKPQFATNVYFTFVE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 33/92 (36%)
CG13589NP_611918.2 DM8 83..171 CDD:214778 33/92 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471944
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.