DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33919

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:176 Identity:49/176 - (27%)
Similarity:80/176 - (45%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLFGLWHILQV---QGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGP 68
            |.:|.|...|.|:   |.|.|...||||......:.|| |.:.|:..::..:::...::.....|
  Fly     5 LVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVS-CHVKAINWNLAVVNMDCFMIVPLHNP 68

  Fly    69 VSMRMQLLKK--ASGYKPFLYNICQSDVCEYLEKRNH-PFINIILSSFGNRTNVN-KCPIPPEIV 129
            : :|||:..|  ::.|||||.:: :..:||.:|:||. |:..|:...|...|||| .||....::
  Fly    69 I-IRMQVFTKDYSNQYKPFLVDV-KIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLI 131

  Fly   130 LEHFRFPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLTEY 175
            .........:|.  |.|.|         |::..|.......|.|:|
  Fly   132 ARDGFLDTSLLP--PFPQG---------FYQVSLVVTDTNSTSTDY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/92 (28%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 28/93 (30%)

Return to query results.
Submit another query.