DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33757

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:186 Identity:57/186 - (30%)
Similarity:93/186 - (50%) Gaps:36/186 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSM 71
            ||.:..|...||::  |||.::.|.:.|.::..:.||::.|:.|....:|::...||.... |.|
  Fly     6 LFFVLVLLTPLQLE--AKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNN-VHM 67

  Fly    72 RMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINI---ILSSFGNRTNVNKCPIPP------- 126
            |::|.|:|:|::|||||| ..::|::|.|||:..:::   .|..:...||.. ||...       
  Fly    68 RLELFKRANGWRPFLYNI-SFNLCDFLSKRNNVIVSLGYEYLKPYIPMTNYT-CPFKKNHLIKCT 130

  Fly   127 --EIVLEHF--RFPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTL---TEY 175
              |..:|.|  |||::.        |:|.|..:|      :.|.||..||   .||
  Fly   131 DLEFDIEKFRVRFPIET--------GEYALQLSF------IVQRKVTLTLNGSAEY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 31/107 (29%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928 30/94 (32%)

Return to query results.
Submit another query.