DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33725

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:155 Identity:49/155 - (31%)
Similarity:82/155 - (52%) Gaps:6/155 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFL 86
            |.||||..|||.::::.....|||.||.|:.|.::....:|. |...:.:.::|.|||:|:||:|
  Fly    26 VFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-PANNIIVHVKLFKKANGFKPWL 89

  Fly    87 YNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCP-IPPEIVLEHFRFPVKVLDMMPLPFGD 149
            .:: :.|.|.::....|||:.||...|.:.:.:| .|| :..::|.:.:..|.|:  .:|.|.||
  Fly    90 LDV-KLDACRFVRTNFHPFVRIIFDLFKDFSTINHTCPYVGLQVVKDFYLRPEKL--KLPFPSGD 151

  Fly   150 YGLFTTFTFHRSELAQVKVYFTLTE 174
            |.|...:.|.:.......|.|...|
  Fly   152 YLLSLIWIFDKRPQFDTNVSFVYAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/92 (28%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 27/82 (33%)

Return to query results.
Submit another query.