DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33630

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster


Alignment Length:100 Identity:20/100 - (20%)
Similarity:42/100 - (42%) Gaps:34/100 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MRMQLLKKASGYKPF--LYNICQSDVCEYLEKRN-HPFINIILSSFGNRTNVNKCPIPPEIVLEH 132
            |.:::..|..|...|  |:.:.:.:.||:|.:.| :|.:.::                       
  Fly    82 MNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNPMMEMM----------------------- 123

  Fly   133 FRFPVKVLDMM--PLPFGDYGLFTTFTFHRSELAQ 165
            |:..||:.|::  |:..|:|.|.      .|::|:
  Fly   124 FKKNVKLNDIIVCPVRVGNYSLL------NSDIAE 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 17/88 (19%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 17/85 (20%)

Return to query results.
Submit another query.