DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33627

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster


Alignment Length:131 Identity:29/131 - (22%)
Similarity:57/131 - (43%) Gaps:32/131 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 KGPVSMRMQLLKKA----SGYKPFL-------------YNICQSDVCEYLEK-RNHPFINIILSS 112
            |..:|..:|.:|..    :.:|.|:             .|:   |:|::.:. ..|.|:.|::.:
  Fly    52 KSAISAELQYIKDLAQFNATFKLFMPRKPSRSFQKVIDVNV---DICQFAKGIHGHRFMTIVIKA 113

  Fly   113 FGNRTNVNKCPIPPEIVLEHFRFP-VKVLDMMP--LPFGDYGLFTTFTFHRSELAQVKVYFTLTE 174
            ||.:.:..|||....:    :.:| :.:.:.:|  ||..|:.:...|.   |..|.| :..|||.
  Fly   114 FGKQGSQLKCPHTKGL----YVYPNINIAENLPAFLPETDFKIEMNFL---SPAAHV-INTTLTG 170

  Fly   175 Y 175
            :
  Fly   171 F 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 23/107 (21%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 18/87 (21%)

Return to query results.
Submit another query.