DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33648

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster


Alignment Length:180 Identity:53/180 - (29%)
Similarity:91/180 - (50%) Gaps:29/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRM 73
            :|:|:..:    .:.:||||:|.|:|.::.....||:.:|.|....:|:.:.:|..|....::.:
  Fly    13 ILYGINDV----SIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPLTNATINV 73

  Fly    74 QLLKKASGYKPFLYNICQSDVCEYL--EKRN----HPFINIILSSFGNRTNVNK--CPIPPEIVL 130
            .|.|:.:||||||||: ..|.|.:|  :|.|    :.|..|:|.|     |:..  ||....|.:
  Fly    74 ALYKRYNGYKPFLYNV-SVDACRFLRTQKSNIVVKYLFDLILLKS-----NIRSPTCPFNSFISV 132

  Fly   131 EHFR---FPVKVLDMMPLPFGDYGLFT----TFTFHRSELAQVKVYFTLT 173
            :...   ...|:..::|:|.||| ||.    ::..:||   .|.||.|::
  Fly   133 DKLTTNFLNNKLTQVLPVPEGDY-LFAFRWFSYNIYRS---SVNVYITIS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 34/105 (32%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 29/92 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472477
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.