DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33798

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:175 Identity:52/175 - (29%)
Similarity:90/175 - (51%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTELFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGP 68
            |..:||      |.:|..:.:.||.||.|.|.||:....|||.:|.|....:||:.::.:.|...
  Fly     8 LVTIFL------IRKVHSLVEITNFECESLDRNFSDFEYCRLKSVNRTYKYISLKVHLFQTPVNQ 66

  Fly    69 VSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRN-HPFINIILSSFGNRTNVN-KCPIPPEIVLE 131
            :.:...:.|:.:||||||||: ..|.|::::.:| :|....|...|.:.||:| .||...:|::|
  Fly    67 IKVNTAIYKRLNGYKPFLYNV-TVDGCKFIKNQNSNPVTKFIFGVFKDATNMNHSCPYDHDIIME 130

  Fly   132 HF---RFPVKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173
            ..   ....::..::|.|.|.|.:...:..:....|.:::|.|||
  Fly   131 KLSAESINFQITKILPFPEGKYMVKMNWFAYDINRAIIRLYITLT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 27/95 (28%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:284008 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472542
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.