DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33775

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:154 Identity:39/154 - (25%)
Similarity:79/154 - (51%) Gaps:3/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVSMRMQLLKKASGYKPFLY 87
            ::|.|::|.|.:|::.....|:|..:.|..|...:...:.:.|.....:...:.::.:|::||||
  Fly    30 SRFINMQCESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINWAMYRRYNGFQPFLY 94

  Fly    88 NICQSDVCEYLEKRNH-PFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPVKVLDMMPLPFGDY 150
            |: .:|:|:.|...|. .|..:::::....:|:| .||...:|::::..|....|..:|||.|.|
  Fly    95 NV-STDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPYNHDIIVDNMEFSDDFLKTLPLPQGVY 158

  Fly   151 GLFTTFTFHRSELAQVKVYFTLTE 174
            .:...|..::....||.|:...||
  Fly   159 KIQLRFATYKVWRVQVAVFIERTE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/92 (28%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:284008 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472568
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.