DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33922

DIOPT Version :9

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster


Alignment Length:172 Identity:47/172 - (27%)
Similarity:86/172 - (50%) Gaps:6/172 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATLTELFLLFGLWHILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPK 66
            |.|.:|.:.....|::..:  .:||||:|::.|..|.....|.|.:|.|.....||:..:|:.|.
  Fly     5 ARLVQLSIFLFTIHLVICK--LEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPV 67

  Fly    67 GPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEKRNHPFINIILSSFGNRTNVN-KCPIPPEIVL 130
            ..|.:.:...::.:||||||||:.......|..:|::|..:...:.|.:.:|:| .||...:|:|
  Fly    68 SNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIIL 132

  Fly   131 EHFRFP---VKVLDMMPLPFGDYGLFTTFTFHRSELAQVKVY 169
            :.....   .:|.:::|:|.|:|.....:..:..:.|.|.||
  Fly   133 DKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVY 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 26/92 (28%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472490
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.