DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33645

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027260.3 Gene:CG33645 / 3771913 FlyBaseID:FBgn0053645 Length:189 Species:Drosophila melanogaster


Alignment Length:96 Identity:16/96 - (16%)
Similarity:31/96 - (32%) Gaps:29/96 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 TELQQCSHCQFRTTSSQELETHQQRIHQSDMEPSEPVYCMLCDRRFSSISGLKYHLKRHTGIKAF 509
            ::..|..:|.|...:....|..::.:.::          .||.|.|..     |.|         
  Fly   270 SQFWQSMYCHFLVLTVSSCERTRKMVEET----------ALCTRHFDD-----YRL--------- 310

  Fly   510 ACLYCEKTFTANSNLNAHIRSVHSARKDYRC 540
                 :.|..|....|..::::|..:|...|
  Fly   311 -----QNTRAAKQIQNFLLKNLHQKKKFSAC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778
CG33645NP_001027260.3 DUF1091 80..156 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.