DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13561 and CG33920

DIOPT Version :10

Sequence 1:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001027214.1 Gene:CG33920 / 3771875 FlyBaseID:FBgn0053920 Length:180 Species:Drosophila melanogaster


Alignment Length:166 Identity:45/166 - (27%)
Similarity:88/166 - (53%) Gaps:11/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANILRWPKGPVS-MRMQLLKKA 79
            |:::....:||||.|.|.|:.|:....|.:.:|.|....:|::|.:.:.|...:: :.::.....
  Fly    18 IVEISSKFEFTNIMCNSLDKQFSDFEYCYIKSVNRSYKYVSIKAKLFKTPITKINGVILKRFNGY 82

  Fly    80 SGYKPFLYNICQSDVCEYLEK-RNHPFINIILSSFGNRTNVN-KCPIPPEIVLEHFRFPV----- 137
            :||:||::|| ..|.|.::.. :::|..:.:.......||:| .||...::|:|  :.|:     
  Fly    83 NGYRPFMFNI-TLDACRFMNNTKSNPIASYLYDFIRPFTNMNHNCPYDHDLVIE--KLPIHFVNH 144

  Fly   138 KVLDMMPLPFGDYGLFTTFTFHRSELAQVKVYFTLT 173
            :|..::|:|.|||...|.:..:....|.||||.|::
  Fly   145 QVTKVLPVPEGDYLYETNWMAYDIRRAVVKVYGTIS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13561NP_611830.3 DM8 82..173 CDD:214778 29/97 (30%)
CG33920NP_001027214.1 DUF1091 71..158 CDD:461928 22/89 (25%)

Return to query results.
Submit another query.